PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0154s0180.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 423aa    MW: 45870 Da    PI: 5.9673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0154s0180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3442.4e-105744193374
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                              lLl+cAe+v+ ++l+ a+ lL ++ el+sp g++ +R+ ayf+ AL+ar+++s+ ++y+ l +++ + ++s++ ++al+ ++ +sP
  SapurV1A.0154s0180.1.p  74 GLLLQCAECVAMDNLNYATDLLPEIVELSSPFGSSPERVGAYFAHALQARVVGSCLGTYSPLVSKSVTLTQSQRLFNALQSYNSISP 160
                             58******************************************************************99***************** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                             ++kfsh+taNqaI +a++ge+rvH+iDfdi+qGlQWp L++ LasRp++  s+RiTg+gs    s+e le+tg+rLa+fA++lg+pf
  SapurV1A.0154s0180.1.p 161 LVKFSHFTANQAIFQALDGEDRVHVIDFDIMQGLQWPGLFHILASRPKKIRSVRITGFGS----SSELLESTGRRLADFASSLGLPF 243
                             ************************************************************....9********************** PP

                    GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                             ef++l  k  +  +l++L v+p+Ea++V++++  h l+d ++s       +Lkl+  l+Pk+++ veq+++h ++sFl rf+eal+y
  SapurV1A.0154s0180.1.p 244 EFHPLEGKIGNVTDLSQLGVRPREAIVVHWMH--HCLYDVTGSDLG----TLKLLTLLRPKLITTVEQDLSH-GGSFLGRFVEALHY 323
                             ****9777777779*****************9..888888888888....**********************.789*********** PP

                    GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                             ysalfd+l  +++ +s er++vE++l+g          g+       ++e+W + l+++GF+pv+l+ + a+qa+lll +++++gy+
  SapurV1A.0154s0180.1.p 324 YSALFDALGDGFGVDSVERHMVEQQLFGT---------GE------VKVERWGDELRRVGFGPVSLGGSPAAQASLLLGMFPWKGYT 395
                             *************************9985.........33......35789************************************ PP

                    GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                             + ee+g+l lgWkd +L+++SaWr
  SapurV1A.0154s0180.1.p 396 LVEENGCLKLGWKDLSLLTASAWR 419
                             ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.7546399IPR005202Transcription factor GRAS
PfamPF035148.4E-10374419IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MLQSLIPQSP INSKDPNNSS SSTMKSKRAA GDLTAADSSS EDPSSKRASY EKPTTETDCR  60
GDDGGEASGL RLLGLLLQCA ECVAMDNLNY ATDLLPEIVE LSSPFGSSPE RVGAYFAHAL  120
QARVVGSCLG TYSPLVSKSV TLTQSQRLFN ALQSYNSISP LVKFSHFTAN QAIFQALDGE  180
DRVHVIDFDI MQGLQWPGLF HILASRPKKI RSVRITGFGS SSELLESTGR RLADFASSLG  240
LPFEFHPLEG KIGNVTDLSQ LGVRPREAIV VHWMHHCLYD VTGSDLGTLK LLTLLRPKLI  300
TTVEQDLSHG GSFLGRFVEA LHYYSALFDA LGDGFGVDSV ERHMVEQQLF GTGEVKVERW  360
GDELRRVGFG PVSLGGSPAA QASLLLGMFP WKGYTLVEEN GCLKLGWKDL SLLTASAWRP  420
AD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-48724194375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000635.10.0PREDICTED: scarecrow-like protein 23 isoform X1
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLB9IHC50.0B9IHC5_POPTR; Uncharacterized protein
STRINGPOPTR_0016s02030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-172GRAS family protein